Lineage for d6ulda1 (6uld A:22-447)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897503Species Mycobacterium tuberculosis [TaxId:1773] [225404] (32 PDB entries)
  8. 2897508Domain d6ulda1: 6uld A:22-447 [375952]
    Other proteins in same PDB: d6ulda2, d6uldb2
    automated match to d3ecda_
    complexed with gly, mpd, plp, ser

Details for d6ulda1

PDB Entry: 6uld (more details), 1.5 Å

PDB Description: crystal structure of serine hydroxymethyltransferase from mycobacterium tuberculosis with bound plp forming a schiff base with substrate serine in one monomer and plp forming a schiff base with product glycine in the other monomer
PDB Compounds: (A:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d6ulda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ulda1 c.67.1.0 (A:22-447) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
msaplaevdpdiaellakelgrqrdtlemiasenfvpravlqaqgsvltnkyaeglpgrr
yyggcehvdvvenlardrakalfgaefanvqphsgaqanaavlhalmspgerllgldlan
gghlthgmrlnfsgklyengfygvdpathlidmdavratalefrpkviiagwsayprvld
faafrsiadevgakllvdmahfaglvaaglhpspvphadvvsttvhktlgggrsglivgk
qqyakainsavfpgqqggplmhviagkavalkiaatpefadrqrrtlsgariiadrlmap
dvakagvsvvsggtdvhlvlvdlrdspldgqaaedllhevgitvnrnavpndprppmvts
glrigtpalatrgfgdteftevadiiatalatgssvdvsalkdratrlarafplydglee
wslvgr

SCOPe Domain Coordinates for d6ulda1:

Click to download the PDB-style file with coordinates for d6ulda1.
(The format of our PDB-style files is described here.)

Timeline for d6ulda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ulda2