Lineage for d1ud7a_ (1ud7 A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30383Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 30384Superfamily d.15.1: Ubiquitin-like [54236] (5 families) (S)
  5. 30385Family d.15.1.1: Ubiquitin-related [54237] (5 proteins)
  6. 30406Protein Ubiquitin [54238] (2 species)
  7. 30407Species Human (Homo sapiens) [TaxId:9606] [54239] (8 PDB entries)
  8. 30417Domain d1ud7a_: 1ud7 A: [37593]

Details for d1ud7a_

PDB Entry: 1ud7 (more details)

PDB Description: solution structure of the designed hydrophobic core mutant of ubiquitin, 1d7

SCOP Domain Sequences for d1ud7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ud7a_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens)}
mqvflktltgktvtievepsdtvenfkakiqdkegippdqqrlifagkqledgrtlsdyn
iqkestihlvlrlrgg

SCOP Domain Coordinates for d1ud7a_:

Click to download the PDB-style file with coordinates for d1ud7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ud7a_: