Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) automatically mapped to Pfam PF00303 |
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins) |
Protein Thymidylate synthase [55833] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [55840] (47 PDB entries) |
Domain d6pf6c1: 6pf6 C:30-313 [375808] Other proteins in same PDB: d6pf6b2, d6pf6c2 automated match to d1hzwa_ complexed with oej, ump |
PDB Entry: 6pf6 (more details), 2.5 Å
SCOPe Domain Sequences for d6pf6c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pf6c1 d.117.1.1 (C:30-313) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]} elqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvleell wfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgaeyrdm esdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvnsels cqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhieplkiql qreprpfpklrilrkvekiddfkaedfqiegynphptikmemav
Timeline for d6pf6c1:
View in 3D Domains from other chains: (mouse over for more information) d6pf6a_, d6pf6b1, d6pf6b2, d6pf6d_ |