Lineage for d6pf6c1 (6pf6 C:30-313)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972108Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2972109Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2972110Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2972208Protein Thymidylate synthase [55833] (7 species)
  7. 2972355Species Human (Homo sapiens) [TaxId:9606] [55840] (47 PDB entries)
  8. 2972435Domain d6pf6c1: 6pf6 C:30-313 [375808]
    Other proteins in same PDB: d6pf6b2, d6pf6c2
    automated match to d1hzwa_
    complexed with oej, ump

Details for d6pf6c1

PDB Entry: 6pf6 (more details), 2.5 Å

PDB Description: crystal structure of ts-dhfr from cryptosporidium hominis in complex with nadph, fdump and 2-(4-((2-amino-4-oxo-4,7-dihydro-3h-pyrrolo[2, 3-d]pyrimidin-5-yl)methyl)benzamido)terephthalic acid
PDB Compounds: (C:) Thymidylate synthase,Thymidylate synthase

SCOPe Domain Sequences for d6pf6c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pf6c1 d.117.1.1 (C:30-313) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]}
elqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvleell
wfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgaeyrdm
esdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvnsels
cqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhieplkiql
qreprpfpklrilrkvekiddfkaedfqiegynphptikmemav

SCOPe Domain Coordinates for d6pf6c1:

Click to download the PDB-style file with coordinates for d6pf6c1.
(The format of our PDB-style files is described here.)

Timeline for d6pf6c1:

  • d6pf6c1 first appeared in SCOPe 2.07, called d6pf6c_