Lineage for d1e3pa4 (1e3p A:346-482)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537228Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2537229Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2537487Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins)
  6. 2537599Protein Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 [54230] (1 species)
    duplication of two-domain units formed by domains 1-2 and 4-5
  7. 2537600Species Streptomyces antibioticus [TaxId:1890] [54231] (2 PDB entries)
  8. 2537602Domain d1e3pa4: 1e3p A:346-482 [37575]
    Other proteins in same PDB: d1e3pa1, d1e3pa2, d1e3pa5, d1e3pa6, d1e3pa7
    complexed with so4, wo4

Details for d1e3pa4

PDB Entry: 1e3p (more details), 2.5 Å

PDB Description: tungstate derivative of streptomyces antibioticus pnpase/gpsi enzyme
PDB Compounds: (A:) guanosine pentaphosphate synthetase

SCOPe Domain Sequences for d1e3pa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3pa4 d.14.1.4 (A:346-482) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 {Streptomyces antibioticus [TaxId: 1890]}
tdirtlaaeveaiprvhgsalfergetqilgvttlnmlrmeqqldtlspvtrkrymhnyn
fppysvgetgrvgspkrreighgalaeraivpvlptreefpyairqvsealgsngstsmg
svcastmsllnagvplk

SCOPe Domain Coordinates for d1e3pa4:

Click to download the PDB-style file with coordinates for d1e3pa4.
(The format of our PDB-style files is described here.)

Timeline for d1e3pa4: