SCOPe 2.05: Domain d1e3pa3: 1e3p A:3-151

Lineage for d1e3pa3 (1e3p A:3-151)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins)

6. Protein Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 [54230] (1 species)
   duplication of two-domain units formed by domains 1-2 and 4-5

7. Species Streptomyces antibioticus [TaxId:1890] [54231] (2 PDB entries)

8. Domain d1e3pa3: 1e3p A:3-151 [37574]
   Other proteins in same PDB: d1e3pa1, d1e3pa2, d1e3pa5, d1e3pa6, d1e3pa7
   complexed with so4, wo4

Details for d1e3pa3

PDB Entry: 1e3p, 2.5 Å

PDB Description: tungstate derivative of streptomyces antibioticus pnpase/gpsi enzyme

PDB Compounds: (A:) guanosine pentaphosphate synthetase

SCOPe Domain Sequences for d1e3pa3:

Sequence; same for both SEQRES and ATOM records:

>d1e3pa3 d.14.1.4 (A:3-151) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 {Streptomyces antibioticus [TaxId: 1890]}
nethyaeavidngafgtrtirfetgrlarqaagsavayldddtmvlsattasknpkdqld
ffpltvdveermyaagkipgsffrregrpsedailtcrlidrplrpsfkkglrneiqvva
timalnpdhlydvvainaasastqlaglp

Timeline for d1e3pa3:

• d1e3pa3 first appeared (with stable ids) in SCOP 1.55
  
• d1e3pa3 appears in SCOPe 2.04
  
• d1e3pa3 appears in SCOPe 2.06
  
• d1e3pa3 appears in the current release, SCOPe 2.08