Lineage for d1e3pa3 (1e3p A:3-151)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30320Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
  4. 30321Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families) (S)
  5. 30365Family d.14.1.4: Polynucleotide phosporylase/guanosine pentaphospate synthase (PNPase/GPSI), domains 1 and 4 [54229] (1 protein)
  6. 30366Protein Polynucleotide phosporylase/guanosine pentaphospate synthase (PNPase/GPSI), domains 1 and 4 [54230] (1 species)
  7. 30367Species Streptomyces antibioticus [TaxId:1890] [54231] (2 PDB entries)
  8. 30370Domain d1e3pa3: 1e3p A:3-151 [37574]
    Other proteins in same PDB: d1e3pa1, d1e3pa2, d1e3pa5, d1e3pa6, d1e3pa7

Details for d1e3pa3

PDB Entry: 1e3p (more details), 2.5 Å

PDB Description: tungstate derivative of streptomyces antibioticus pnpase/gpsi enzyme

SCOP Domain Sequences for d1e3pa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3pa3 d.14.1.4 (A:3-151) Polynucleotide phosporylase/guanosine pentaphospate synthase (PNPase/GPSI), domains 1 and 4 {Streptomyces antibioticus}
nethyaeavidngafgtrtirfetgrlarqaagsavayldddtmvlsattasknpkdqld
ffpltvdveermyaagkipgsffrregrpsedailtcrlidrplrpsfkkglrneiqvva
timalnpdhlydvvainaasastqlaglp

SCOP Domain Coordinates for d1e3pa3:

Click to download the PDB-style file with coordinates for d1e3pa3.
(The format of our PDB-style files is described here.)

Timeline for d1e3pa3: