SCOP 1.75: Domain d1e3ha3: 1e3h A:346-482

Lineage for d1e3ha3 (1e3h A:346-482)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families)

5. Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (10 proteins)

6. Protein Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 [54230] (1 species)
   duplication of two-domain units formed by domains 1-2 and 4-5

7. Species Streptomyces antibioticus [TaxId:1890] [54231] (2 PDB entries)

8. Domain d1e3ha3: 1e3h A:346-482 [37573]
   Other proteins in same PDB: d1e3ha1, d1e3ha4, d1e3ha5, d1e3ha6
   complexed with so4

Details for d1e3ha3

PDB Entry: 1e3h, 2.6 Å

PDB Description: semet derivative of streptomyces antibioticus pnpase/gpsi enzyme

PDB Compounds: (A:) guanosine pentaphosphate synthetase

SCOP Domain Sequences for d1e3ha3:

Sequence; same for both SEQRES and ATOM records:

>d1e3ha3 d.14.1.4 (A:346-482) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 {Streptomyces antibioticus [TaxId: 1890]}
tdirtlaaeveaiprvhgsalfergetqilgvttlnmlrmeqqldtlspvtrkrymhnyn
fppysvgetgrvgspkrreighgalaeraivpvlptreefpyairqvsealgsngstsmg
svcastmsllnagvplk

Timeline for d1e3ha3:

• d1e3ha3 first appeared (with stable ids) in SCOP 1.55
  
• d1e3ha3 appears in SCOP 1.73
  
• d1e3ha3 appears in SCOPe 2.01
  
• d1e3ha3 appears in the current release, SCOPe 2.08