Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) |
Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (2 proteins) |
Protein Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 [54230] (1 species) duplication of two-domain units formed by domains 1-2 and 4-5 |
Species Streptomyces antibioticus [TaxId:1890] [54231] (2 PDB entries) |
Domain d1e3ha3: 1e3h A:346-482 [37573] Other proteins in same PDB: d1e3ha1, d1e3ha4, d1e3ha5, d1e3ha6 complexed with so4 |
PDB Entry: 1e3h (more details), 2.6 Å
SCOP Domain Sequences for d1e3ha3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e3ha3 d.14.1.4 (A:346-482) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 {Streptomyces antibioticus [TaxId: 1890]} tdirtlaaeveaiprvhgsalfergetqilgvttlnmlrmeqqldtlspvtrkrymhnyn fppysvgetgrvgspkrreighgalaeraivpvlptreefpyairqvsealgsngstsmg svcastmsllnagvplk
Timeline for d1e3ha3: