Lineage for d1e3ha3 (1e3h A:346-482)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30320Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
  4. 30321Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families) (S)
  5. 30365Family d.14.1.4: Polynucleotide phosporylase/guanosine pentaphospate synthase (PNPase/GPSI), domains 1 and 4 [54229] (1 protein)
  6. 30366Protein Polynucleotide phosporylase/guanosine pentaphospate synthase (PNPase/GPSI), domains 1 and 4 [54230] (1 species)
  7. 30367Species Streptomyces antibioticus [TaxId:1890] [54231] (2 PDB entries)
  8. 30369Domain d1e3ha3: 1e3h A:346-482 [37573]
    Other proteins in same PDB: d1e3ha1, d1e3ha4, d1e3ha5, d1e3ha6

Details for d1e3ha3

PDB Entry: 1e3h (more details), 2.6 Å

PDB Description: semet derivative of streptomyces antibioticus pnpase/gpsi enzyme

SCOP Domain Sequences for d1e3ha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3ha3 d.14.1.4 (A:346-482) Polynucleotide phosporylase/guanosine pentaphospate synthase (PNPase/GPSI), domains 1 and 4 {Streptomyces antibioticus}
tdirtlaaeveaiprvhgsalfergetqilgvttlnmlrmeqqldtlspvtrkrymhnyn
fppysvgetgrvgspkrreighgalaeraivpvlptreefpyairqvsealgsngstsmg
svcastmsllnagvplk

SCOP Domain Coordinates for d1e3ha3:

Click to download the PDB-style file with coordinates for d1e3ha3.
(The format of our PDB-style files is described here.)

Timeline for d1e3ha3: