Lineage for d1e3ha3 (1e3h A:346-482)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930318Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins)
  6. 2930430Protein Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 [54230] (1 species)
    duplication of two-domain units formed by domains 1-2 and 4-5
  7. 2930431Species Streptomyces antibioticus [TaxId:1890] [54231] (2 PDB entries)
  8. 2930435Domain d1e3ha3: 1e3h A:346-482 [37573]
    Other proteins in same PDB: d1e3ha1, d1e3ha4, d1e3ha5, d1e3ha6
    complexed with so4

Details for d1e3ha3

PDB Entry: 1e3h (more details), 2.6 Å

PDB Description: semet derivative of streptomyces antibioticus pnpase/gpsi enzyme
PDB Compounds: (A:) guanosine pentaphosphate synthetase

SCOPe Domain Sequences for d1e3ha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3ha3 d.14.1.4 (A:346-482) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 {Streptomyces antibioticus [TaxId: 1890]}
tdirtlaaeveaiprvhgsalfergetqilgvttlnmlrmeqqldtlspvtrkrymhnyn
fppysvgetgrvgspkrreighgalaeraivpvlptreefpyairqvsealgsngstsmg
svcastmsllnagvplk

SCOPe Domain Coordinates for d1e3ha3:

Click to download the PDB-style file with coordinates for d1e3ha3.
(The format of our PDB-style files is described here.)

Timeline for d1e3ha3: