SCOPe 2.08: Domain d6mppa1: 6mpp A:1-181

Lineage for d6mppa1 (6mpp A:1-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-B35 [TaxId:9606] [54475] (16 PDB entries)
   Uniprot P30685 25-300

8. Domain d6mppa1: 6mpp A:1-181 [375660]
   Other proteins in same PDB: d6mppa2, d6mppc1, d6mppc2
   automated match to d1xh3a2
   mutant

Details for d6mppa1

PDB Entry: 6mpp

PDB Description: hla-a*01:01 complex with nras q61k peptide by nmr

PDB Compounds: (A:) HLA class I histocompatibility antigen, A-1 alpha chain

SCOPe Domain Sequences for d6mppa1:

Sequence; same for both SEQRES and ATOM records:

>d6mppa1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B35 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqkmeprapwieqegpeyw
dqetrnmkahsqtdranlgtlrgyynqsedgshtiqimygcdvgpdgrflrgyrqdaydg
kdyialnedlrswtaadmaaqitkrkweavhaaeqrrvylegrcvdglrrylengketlq
r

Timeline for d6mppa1:

• d6mppa1 first appeared in SCOPe 2.07