SCOP 1.69: Domain d1a6f__: 1a6f -

Lineage for d1a6f__ (1a6f -)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (11 families)

5. Family d.14.1.2: RNase P protein [54220] (1 protein)

6. Protein RNase P protein [54221] (3 species)

7. Species Bacillus subtilis [TaxId:1423] [54222] (1 PDB entry)

8. Domain d1a6f__: 1a6f - [37564]

Details for d1a6f__

PDB Entry: 1a6f, 2.6 Å

PDB Description: rnase p protein from bacillus subtilis

SCOP Domain Sequences for d1a6f__:

Sequence; same for both SEQRES and ATOM records:

>d1a6f__ d.14.1.2 (-) RNase P protein {Bacillus subtilis}
ahlkkrnrlkknedfqkvfkhgtsvanrqfvlytldqpendelrvglsvskkignavmrn
rikrlirqafleekerlkekdyiiiarkpasqltyeetkkslqhlfrksslyk

Timeline for d1a6f__:

• d1a6f__ first appeared (with stable ids) in SCOP 1.55
  
• d1a6f__ appears in SCOP 1.67
  
• d1a6f__ appears in SCOP 1.71
  
• d1a6f__ appears in the current release, SCOPe 2.08, called d1a6fa_