Lineage for d6l2ha3 (6l2h A:529-615)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766480Species Paenibacillus macerans [TaxId:44252] [256324] (4 PDB entries)
  8. 2766483Domain d6l2ha3: 6l2h A:529-615 [375639]
    Other proteins in same PDB: d6l2ha1, d6l2ha2, d6l2ha4
    automated match to d4jcla3
    complexed with ca; mutant

Details for d6l2ha3

PDB Entry: 6l2h (more details), 2.1 Å

PDB Description: cgtase mutant-y167h
PDB Compounds: (A:) Alpha-cyclodextrin glucanotransferase

SCOPe Domain Sequences for d6l2ha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6l2ha3 b.1.18.0 (A:529-615) automated matches {Paenibacillus macerans [TaxId: 44252]}
tspaignvgptmgqpgnivtidgrgfggtagtvyfgttvvtgsgivswedtqikavipkv
aagktgvsvktssgtasntfksfnvlt

SCOPe Domain Coordinates for d6l2ha3:

Click to download the PDB-style file with coordinates for d6l2ha3.
(The format of our PDB-style files is described here.)

Timeline for d6l2ha3: