![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families) ![]() |
![]() | Family d.14.1.1: Translational machinery components [54212] (3 proteins) |
![]() | Protein Ribosomal protein S9 [54218] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54219] (10 PDB entries) |
![]() | Domain d1hnwi_: 1hnw I: [37562] Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_ |
PDB Entry: 1hnw (more details), 3.4 Å
SCOP Domain Sequences for d1hnwi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnwi_ d.14.1.1 (I:) Ribosomal protein S9 {Thermus thermophilus} eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr apqyskr
Timeline for d1hnwi_: