Lineage for d6k2oa1 (6k2o A:2-160)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) 
Family b.29.1.0: automated matches [191363] (1 protein)
not a true familyProtein automated matches [190437] (70 species)
not a true protein
Species Rotavirus a [TaxId:28875] [277665] (11 PDB entries) 
Domain d6k2oa1: 6k2o A:2-160 [375617]
Other proteins in same PDB: d6k2oa2
automated match to d5jdba_
complexed with fuc, na, nag
Details for d6k2oa1
PDB Entry: 6k2o (more details), 2.3 Å
PDB Description: structural basis of glycan recognition in globally predominant human p[8] rotavirus
PDB Compounds: (A:) Outer capsid protein VP4SCOPe Domain Sequences for d6k2oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6k2oa1 b.29.1.0 (A:2-160) automated matches {Rotavirus a [TaxId: 28875]}
ldgpyqpttftppidywilinsntngvvyestnnsdfwtavvaiephvnpvdrqytvfge
nkqfnvrndsdkwkflemfrsssqnefynrrtltsdtklvgilkyggriwtfhgetprat
tdssntanlndisiiihsefyiiprsqeskcneyinngl
SCOPe Domain Coordinates for d6k2oa1:
Click to download the PDB-style file with coordinates for d6k2oa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6k2oa1:
- d6k2oa1 first appeared in SCOPe 2.07
View in 3D
