Lineage for d1hr0i_ (1hr0 I:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2176343Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2176344Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2176345Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 2176455Protein Ribosomal protein S9 [54218] (2 species)
  7. 2176483Species Thermus thermophilus [TaxId:274] [54219] (39 PDB entries)
    Uniprot P80374
  8. 2176492Domain d1hr0i_: 1hr0 I: [37560]
    Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_
    complexed with mg, zn

Details for d1hr0i_

PDB Entry: 1hr0 (more details), 3.2 Å

PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
PDB Compounds: (I:) 30S ribosomal protein S9

SCOPe Domain Sequences for d1hr0i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr0i_ d.14.1.1 (I:) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr

SCOPe Domain Coordinates for d1hr0i_:

Click to download the PDB-style file with coordinates for d1hr0i_.
(The format of our PDB-style files is described here.)

Timeline for d1hr0i_: