![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families) ![]() |
![]() | Family d.14.1.1: Translational machinery components [54212] (3 proteins) |
![]() | Protein Ribosomal protein S9 [54218] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54219] (10 PDB entries) |
![]() | Domain d1fjfi_: 1fjf I: [37558] Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfc2, d1fjfd_, d1fjfe1, d1fjfe2, d1fjff_, d1fjfg_, d1fjfh_, d1fjfj_, d1fjfk_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjfs_, d1fjft_, d1fjfv_ |
PDB Entry: 1fjf (more details), 3.05 Å
SCOP Domain Sequences for d1fjfi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fjfi_ d.14.1.1 (I:) Ribosomal protein S9 {Thermus thermophilus} eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr apqyskr
Timeline for d1fjfi_: