SCOPe 2.08: Domain d6jljm_: 6jlj M:

Lineage for d6jljm_ (6jlj M:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family)
   automatically mapped to Pfam PF05151

5. Family f.23.35.1: PsbM-like [161034] (2 proteins)
   Pfam PF05151

6. Protein Photosystem II reaction center protein M, PsbM [161035] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189918] (21 PDB entries)

8. Domain d6jljm_: 6jlj M: [375577]
   Other proteins in same PDB: d6jlja_, d6jljb_, d6jljc_, d6jljd_, d6jlje_, d6jljf_, d6jljh_, d6jlji_, d6jljj_, d6jljk_, d6jljl_, d6jljo_, d6jljt_, d6jlju_, d6jljv_, d6jljx_, d6jljz_
   automated match to d2axtm1
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d6jljm_

PDB Entry: 6jlj, 2.15 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (dark state, dataset1)

PDB Compounds: (M:) Photosystem II reaction center protein M

SCOPe Domain Sequences for d6jljm_:

Sequence; same for both SEQRES and ATOM records:

>d6jljm_ f.23.35.1 (M:) Photosystem II reaction center protein M, PsbM {Thermosynechococcus vulcanus [TaxId: 32053]}
mevnqlgliatalfvlvpsvfliilyvqtesqqk

Timeline for d6jljm_:

• d6jljm_ first appeared in SCOPe 2.07