Lineage for d1hnxe1 (1hnx E:74-154)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716671Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 716672Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 716673Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 716713Protein Ribosomal protein S5, C-terminal domain [54215] (2 species)
  7. 716716Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries)
  8. 716731Domain d1hnxe1: 1hnx E:74-154 [37557]
    Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_
    complexed with mg, pcy, zn

Details for d1hnxe1

PDB Entry: 1hnx (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
PDB Compounds: (E:) 30S ribosomal protein S5

SCOP Domain Sequences for d1hnxe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnxe1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

SCOP Domain Coordinates for d1hnxe1:

Click to download the PDB-style file with coordinates for d1hnxe1.
(The format of our PDB-style files is described here.)

Timeline for d1hnxe1: