| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) ![]() automatically mapped to Pfam PF00737 |
| Family f.23.33.1: PsbH-like [161026] (2 proteins) Pfam PF00737 |
| Protein Photosystem II reaction center protein H, PsbH [161027] (2 species) |
| Species Thermosynechococcus vulcanus [TaxId:32053] [267726] (20 PDB entries) |
| Domain d6jlmh_: 6jlm h: [375560] Other proteins in same PDB: d6jlma_, d6jlmb_, d6jlmc_, d6jlmd_, d6jlme_, d6jlmf_, d6jlmi_, d6jlmj_, d6jlmk_, d6jlml_, d6jlmm_, d6jlmo_, d6jlmt_, d6jlmu_, d6jlmv_, d6jlmx_, d6jlmz_ automated match to d5v2ch_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 6jlm (more details), 2.35 Å
SCOPe Domain Sequences for d6jlmh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jlmh_ f.23.33.1 (h:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus vulcanus [TaxId: 32053]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wkalg
Timeline for d6jlmh_: