| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.5: PsbZ-like [161055] (2 families) ![]() automatically mapped to Pfam PF01737 |
| Family f.17.5.1: PsbZ-like [161056] (1 protein) Pfam PF01737; Ycf9 |
| Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species) |
| Species Thermosynechococcus vulcanus [TaxId:32053] [192451] (30 PDB entries) |
| Domain d6jljz_: 6jlj z: [375559] Other proteins in same PDB: d6jlja_, d6jljb_, d6jljc_, d6jljd_, d6jlje_, d6jljf_, d6jljh_, d6jlji_, d6jljj_, d6jljk_, d6jljl_, d6jljm_, d6jljo_, d6jljt_, d6jlju_, d6jljv_, d6jljx_ automated match to d5h2fz_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 6jlj (more details), 2.15 Å
SCOPe Domain Sequences for d6jljz_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jljz_ f.17.5.1 (z:) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus vulcanus [TaxId: 32053]}
mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff
vv
Timeline for d6jljz_: