Lineage for d1hnze1 (1hnz E:74-154)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194044Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1194045Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1194046Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 1194087Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)
  7. 1194115Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries)
    Uniprot P27152 ! Uniprot P80373
  8. 1194128Domain d1hnze1: 1hnz E:74-154 [37555]
    Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze2, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_
    complexed with hyg, mg, zn

Details for d1hnze1

PDB Entry: 1hnz (more details), 3.3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d1hnze1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnze1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

SCOPe Domain Coordinates for d1hnze1:

Click to download the PDB-style file with coordinates for d1hnze1.
(The format of our PDB-style files is described here.)

Timeline for d1hnze1: