| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) ![]() Pfam PF06596 |
| Family f.23.40.1: PsbX-like [267615] (2 proteins) |
| Protein automated matches [267680] (2 species) not a true protein |
| Species Thermosynechococcus vulcanus [TaxId:32053] [267915] (26 PDB entries) |
| Domain d6jlmx_: 6jlm X: [375534] Other proteins in same PDB: d6jlma_, d6jlmb_, d6jlmc_, d6jlmd_, d6jlme_, d6jlmf_, d6jlmh_, d6jlmi_, d6jlmj_, d6jlmk_, d6jlml_, d6jlmm_, d6jlmo_, d6jlmt_, d6jlmu_, d6jlmv_, d6jlmz_ automated match to d4il6x_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 6jlm (more details), 2.35 Å
SCOPe Domain Sequences for d6jlmx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jlmx_ f.23.40.1 (X:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
titpslkgffigllsgavvlgltfavliaisqidkvqrs
Timeline for d6jlmx_: