SCOP 1.57: Domain d1fjfe1: 1fjf E:74-154

Lineage for d1fjfe1 (1fjf E:74-154)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families)

5. Family d.14.1.1: Translational machinery components [54212] (3 proteins)

6. Protein Ribosomal protein S5, C-terminal domain [54215] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54217] (10 PDB entries)

8. Domain d1fjfe1: 1fjf E:74-154 [37552]
   Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfc2, d1fjfd_, d1fjfe2, d1fjff_, d1fjfg_, d1fjfh_, d1fjfi_, d1fjfj_, d1fjfk_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjfs_, d1fjft_, d1fjfv_

Details for d1fjfe1

PDB Entry: 1fjf, 3.05 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit

SCOP Domain Sequences for d1fjfe1:

Sequence; same for both SEQRES and ATOM records:

>d1fjfe1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

Timeline for d1fjfe1:

• d1fjfe1 first appeared (with stable ids) in SCOP 1.55
  
• d1fjfe1 last appears in SCOP 1.59