![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families) ![]() automatically mapped to Pfam PF01788 |
![]() | Family f.23.32.1: PsbJ-like [161022] (2 proteins) Pfam PF01788 |
![]() | Protein automated matches [191002] (3 species) not a true protein |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [189916] (25 PDB entries) |
![]() | Domain d6jloj_: 6jlo J: [375519] Other proteins in same PDB: d6jloa_, d6jlob_, d6jloc_, d6jlod_, d6jloe_, d6jlof_, d6jloh_, d6jloi_, d6jlok_, d6jlol_, d6jlom_, d6jloo_, d6jlot_, d6jlou_, d6jlov_, d6jlox_, d6jloz_ automated match to d5ws5j_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl |
PDB Entry: 6jlo (more details), 2.4 Å
SCOPe Domain Sequences for d6jloj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jloj_ f.23.32.1 (J:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} seggriplwivatvagmgvivivglffygayaglgssl
Timeline for d6jloj_: