SCOPe 2.07: Domain d6jljd_: 6jlj d:

Lineage for d6jljd_ (6jlj d:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (14 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189911] (26 PDB entries)

8. Domain d6jljd_: 6jlj d: [375517]
   Other proteins in same PDB: d6jljb_, d6jljc_, d6jlje_, d6jljf_, d6jljh_, d6jlji_, d6jljj_, d6jljk_, d6jljl_, d6jljm_, d6jljo_, d6jljt_, d6jlju_, d6jljv_, d6jljx_, d6jljz_
   automated match to d5zznd_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d6jljd_

PDB Entry: 6jlj, 2.15 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (dark state, dataset1)

PDB Compounds: (d:) Photosystem II D2 protein

SCOPe Domain Sequences for d6jljd_:

Sequence; same for both SEQRES and ATOM records:

>d6jljd_ f.26.1.1 (d:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
rgwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegc
nfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfe
iarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnw
tlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanr
fwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpef
etfytknlllnegirawmapqdqphenfvfpeevlprgnal

Timeline for d6jljd_:

• d6jljd_ is new in SCOPe 2.07-stable
  
• d6jljd_ appears in the current release, SCOPe 2.08