Lineage for d1pkpa1 (1pkp A:78-148)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537228Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2537229Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2537230Family d.14.1.1: Translational machinery components [54212] (5 proteins)
  6. 2537278Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)
  7. 2537279Species Bacillus stearothermophilus [TaxId:1422] [54216] (1 PDB entry)
  8. 2537280Domain d1pkpa1: 1pkp A:78-148 [37551]
    Other proteins in same PDB: d1pkpa2

Details for d1pkpa1

PDB Entry: 1pkp (more details), 2.8 Å

PDB Description: the structure of ribosomal protein s5 reveals sites of interaction with 16s rrna
PDB Compounds: (A:) ribosomal protein s5

SCOPe Domain Sequences for d1pkpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkpa1 d.14.1.1 (A:78-148) Ribosomal protein S5, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
gttiphevighfgageiilkpasegtgviaggparavlelagisdilsksigsntpinmv
ratfdglkqlk

SCOPe Domain Coordinates for d1pkpa1:

Click to download the PDB-style file with coordinates for d1pkpa1.
(The format of our PDB-style files is described here.)

Timeline for d1pkpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pkpa2