SCOPe 2.02: Domain d1pkpa1: 1pkp A:78-148

Lineage for d1pkpa1 (1pkp A:78-148)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.1: Translational machinery components [54212] (4 proteins)

6. Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [54216] (1 PDB entry)

8. Domain d1pkpa1: 1pkp A:78-148 [37551]
   Other proteins in same PDB: d1pkpa2

Details for d1pkpa1

PDB Entry: 1pkp, 2.8 Å

PDB Description: the structure of ribosomal protein s5 reveals sites of interaction with 16s rrna

PDB Compounds: (A:) ribosomal protein s5

SCOPe Domain Sequences for d1pkpa1:

Sequence; same for both SEQRES and ATOM records:

>d1pkpa1 d.14.1.1 (A:78-148) Ribosomal protein S5, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
gttiphevighfgageiilkpasegtgviaggparavlelagisdilsksigsntpinmv
ratfdglkqlk

Timeline for d1pkpa1:

• d1pkpa1 first appeared (with stable ids) in SCOP 1.55, called d1pkp_1
  
• d1pkpa1 appears in SCOPe 2.01
  
• d1pkpa1 appears in SCOPe 2.03
  
• d1pkpa1 appears in the current release, SCOPe 2.08