Lineage for d1pkp_1 (1pkp 78-148)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30320Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
  4. 30321Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families) (S)
  5. 30322Family d.14.1.1: Translational machinery components [54212] (3 proteins)
  6. 30330Protein Ribosomal protein S5, C-terminal domain [54215] (2 species)
  7. 30331Species Bacillus stearothermophilus [TaxId:1422] [54216] (1 PDB entry)
  8. 30332Domain d1pkp_1: 1pkp 78-148 [37551]
    Other proteins in same PDB: d1pkp_2

Details for d1pkp_1

PDB Entry: 1pkp (more details), 2.8 Å

PDB Description: the structure of ribosomal protein s5 reveals sites of interaction with 16s rrna

SCOP Domain Sequences for d1pkp_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkp_1 d.14.1.1 (78-148) Ribosomal protein S5, C-terminal domain {Bacillus stearothermophilus}
gttiphevighfgageiilkpasegtgviaggparavlelagisdilsksigsntpinmv
ratfdglkqlk

SCOP Domain Coordinates for d1pkp_1:

Click to download the PDB-style file with coordinates for d1pkp_1.
(The format of our PDB-style files is described here.)

Timeline for d1pkp_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pkp_2