Lineage for d1pkp_1 (1pkp 78-148)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families) 
Family d.14.1.1: Translational machinery components [54212] (3 proteins) 
Protein Ribosomal protein S5, C-terminal domain [54215] (2 species) Species Bacillus stearothermophilus [TaxId:1422] [54216] (1 PDB entry) 
Domain d1pkp_1: 1pkp 78-148 [37551]
Other proteins in same PDB: d1pkp_2
Details for d1pkp_1
PDB Entry: 1pkp (more details), 2.8 Å
PDB Description: the structure of ribosomal protein s5 reveals sites of interaction with 16s rrna
SCOP Domain Sequences for d1pkp_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pkp_1 d.14.1.1 (78-148) Ribosomal protein S5, C-terminal domain {Bacillus stearothermophilus}
gttiphevighfgageiilkpasegtgviaggparavlelagisdilsksigsntpinmv
ratfdglkqlk
SCOP Domain Coordinates for d1pkp_1:
Click to download the PDB-style file with coordinates for d1pkp_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pkp_1:
- d1pkp_1 appears in SCOP 1.57
- d1pkp_1 appears in the current release, SCOPe 2.08, called d1pkpa1
View in 3D
