![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.1: Translational machinery components [54212] (5 proteins) |
![]() | Protein Ribosomal protein S5, C-terminal domain [54215] (3 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [54216] (1 PDB entry) |
![]() | Domain d1pkpa1: 1pkp A:78-148 [37551] Other proteins in same PDB: d1pkpa2 |
PDB Entry: 1pkp (more details), 2.8 Å
SCOPe Domain Sequences for d1pkpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pkpa1 d.14.1.1 (A:78-148) Ribosomal protein S5, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} gttiphevighfgageiilkpasegtgviaggparavlelagisdilsksigsntpinmv ratfdglkqlk
Timeline for d1pkpa1: