![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) ![]() automatically mapped to Pfam PF00737 |
![]() | Family f.23.33.1: PsbH-like [161026] (2 proteins) Pfam PF00737 |
![]() | Protein Photosystem II reaction center protein H, PsbH [161027] (2 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [267726] (20 PDB entries) |
![]() | Domain d6jljh_: 6jlj h: [375503] Other proteins in same PDB: d6jlja_, d6jljb_, d6jljc_, d6jljd_, d6jlje_, d6jljf_, d6jlji_, d6jljj_, d6jljk_, d6jljl_, d6jljm_, d6jljo_, d6jljt_, d6jlju_, d6jljv_, d6jljx_, d6jljz_ automated match to d5v2ch_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 6jlj (more details), 2.15 Å
SCOPe Domain Sequences for d6jljh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jljh_ f.23.33.1 (h:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus vulcanus [TaxId: 32053]} arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs wkalg
Timeline for d6jljh_: