Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) automatically mapped to Pfam PF02532 |
Family f.23.37.1: PsbI-like [161042] (1 protein) Pfam PF02532 |
Protein Photosystem II reaction center protein I, PsbI [161043] (3 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [224950] (24 PDB entries) |
Domain d6jloi_: 6jlo I: [375502] Other proteins in same PDB: d6jloa_, d6jlob_, d6jloc_, d6jlod_, d6jloe_, d6jlof_, d6jloh_, d6jloj_, d6jlok_, d6jlol_, d6jlom_, d6jloo_, d6jlot_, d6jlou_, d6jlov_, d6jlox_, d6jloz_ automated match to d2axti1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl |
PDB Entry: 6jlo (more details), 2.4 Å
SCOPe Domain Sequences for d6jloi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jloi_ f.23.37.1 (I:) Photosystem II reaction center protein I, PsbI {Thermosynechococcus vulcanus [TaxId: 32053]} metlkitvyivvtffvllfvfgflsgdparnpkrkdle
Timeline for d6jloi_: