Lineage for d6jljx_ (6jlj x:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2632179Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) (S)
    Pfam PF06596
  5. 2632180Family f.23.40.1: PsbX-like [267615] (2 proteins)
  6. 2632184Protein automated matches [267680] (2 species)
    not a true protein
  7. 2632198Species Thermosynechococcus vulcanus [TaxId:32053] [267915] (26 PDB entries)
  8. 2632211Domain d6jljx_: 6jlj x: [375500]
    Other proteins in same PDB: d6jlja_, d6jljb_, d6jljc_, d6jljd_, d6jlje_, d6jljf_, d6jljh_, d6jlji_, d6jljj_, d6jljk_, d6jljl_, d6jljm_, d6jljo_, d6jljt_, d6jlju_, d6jljv_, d6jljz_
    automated match to d4il6x_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d6jljx_

PDB Entry: 6jlj (more details), 2.15 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (dark state, dataset1)
PDB Compounds: (x:) Photosystem II reaction center protein X

SCOPe Domain Sequences for d6jljx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jljx_ f.23.40.1 (x:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
titpslkgffigllsgavvlgltfavliaisqidkvqr

SCOPe Domain Coordinates for d6jljx_:

Click to download the PDB-style file with coordinates for d6jljx_.
(The format of our PDB-style files is described here.)

Timeline for d6jljx_: