![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) ![]() Pfam PF06596 |
![]() | Family f.23.40.1: PsbX-like [267615] (2 proteins) |
![]() | Protein automated matches [267680] (2 species) not a true protein |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [267915] (26 PDB entries) |
![]() | Domain d6jljx_: 6jlj x: [375500] Other proteins in same PDB: d6jlja_, d6jljb_, d6jljc_, d6jljd_, d6jlje_, d6jljf_, d6jljh_, d6jlji_, d6jljj_, d6jljk_, d6jljl_, d6jljm_, d6jljo_, d6jljt_, d6jlju_, d6jljv_, d6jljz_ automated match to d4il6x_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 6jlj (more details), 2.15 Å
SCOPe Domain Sequences for d6jljx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jljx_ f.23.40.1 (x:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} titpslkgffigllsgavvlgltfavliaisqidkvqr
Timeline for d6jljx_: