Lineage for d6jlmm_ (6jlm M:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631923Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) (S)
    automatically mapped to Pfam PF05151
  5. 2631924Family f.23.35.1: PsbM-like [161034] (2 proteins)
    Pfam PF05151
  6. 2631925Protein Photosystem II reaction center protein M, PsbM [161035] (2 species)
  7. 2631938Species Thermosynechococcus vulcanus [TaxId:32053] [189918] (21 PDB entries)
  8. 2631953Domain d6jlmm_: 6jlm M: [375498]
    Other proteins in same PDB: d6jlma_, d6jlmb_, d6jlmc_, d6jlmd_, d6jlme_, d6jlmf_, d6jlmh_, d6jlmi_, d6jlmj_, d6jlmk_, d6jlml_, d6jlmo_, d6jlmt_, d6jlmu_, d6jlmv_, d6jlmx_, d6jlmz_
    automated match to d2axtm1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d6jlmm_

PDB Entry: 6jlm (more details), 2.35 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (dark state, dataset2)
PDB Compounds: (M:) Photosystem II reaction center protein M

SCOPe Domain Sequences for d6jlmm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jlmm_ f.23.35.1 (M:) Photosystem II reaction center protein M, PsbM {Thermosynechococcus vulcanus [TaxId: 32053]}
mevnqlgliatalfvlvpsvfliilyvqtesqqk

SCOPe Domain Coordinates for d6jlmm_:

Click to download the PDB-style file with coordinates for d6jlmm_.
(The format of our PDB-style files is described here.)

Timeline for d6jlmm_: