| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
| Protein Cytochrome c550 [100991] (3 species) |
| Species Thermosynechococcus vulcanus [TaxId:32053] [259629] (18 PDB entries) |
| Domain d6jljv_: 6jlj v: [375487] Other proteins in same PDB: d6jlja_, d6jljb_, d6jljc_, d6jljd_, d6jlje_, d6jljf_, d6jljh_, d6jlji_, d6jljj_, d6jljk_, d6jljl_, d6jljm_, d6jljo_, d6jljt_, d6jlju_, d6jljx_, d6jljz_ automated match to d5h2fv_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 6jlj (more details), 2.15 Å
SCOPe Domain Sequences for d6jljv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jljv_ a.3.1.1 (v:) Cytochrome c550 {Thermosynechococcus vulcanus [TaxId: 32053]}
aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
vepkilgdkwgggkvyy
Timeline for d6jljv_: