SCOPe 2.08: Domain d6jljv_: 6jlj v:

Lineage for d6jljv_ (6jlj v:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c550 [100991] (3 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [259629] (18 PDB entries)

8. Domain d6jljv_: 6jlj v: [375487]
   Other proteins in same PDB: d6jlja_, d6jljb_, d6jljc_, d6jljd_, d6jlje_, d6jljf_, d6jljh_, d6jlji_, d6jljj_, d6jljk_, d6jljl_, d6jljm_, d6jljo_, d6jljt_, d6jlju_, d6jljx_, d6jljz_
   automated match to d5h2fv_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d6jljv_

PDB Entry: 6jlj, 2.15 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (dark state, dataset1)

PDB Compounds: (v:) cytochrome c-550

SCOPe Domain Sequences for d6jljv_:

Sequence; same for both SEQRES and ATOM records:

>d6jljv_ a.3.1.1 (v:) Cytochrome c550 {Thermosynechococcus vulcanus [TaxId: 32053]}
aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
vepkilgdkwgggkvyy

Timeline for d6jljv_:

• d6jljv_ first appeared in SCOPe 2.07