Lineage for d6jlji_ (6jlj i:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2632032Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) (S)
    automatically mapped to Pfam PF02532
  5. 2632033Family f.23.37.1: PsbI-like [161042] (1 protein)
    Pfam PF02532
  6. 2632034Protein Photosystem II reaction center protein I, PsbI [161043] (3 species)
  7. 2632048Species Thermosynechococcus vulcanus [TaxId:32053] [224950] (24 PDB entries)
  8. 2632058Domain d6jlji_: 6jlj i: [375483]
    Other proteins in same PDB: d6jlja_, d6jljb_, d6jljc_, d6jljd_, d6jlje_, d6jljf_, d6jljh_, d6jljj_, d6jljk_, d6jljl_, d6jljm_, d6jljo_, d6jljt_, d6jlju_, d6jljv_, d6jljx_, d6jljz_
    automated match to d3arci_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d6jlji_

PDB Entry: 6jlj (more details), 2.15 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (dark state, dataset1)
PDB Compounds: (i:) Photosystem II reaction center protein I

SCOPe Domain Sequences for d6jlji_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jlji_ f.23.37.1 (i:) Photosystem II reaction center protein I, PsbI {Thermosynechococcus vulcanus [TaxId: 32053]}
metlkitvyivvtffvllfvfgflsgdparnpkrkdle

SCOPe Domain Coordinates for d6jlji_:

Click to download the PDB-style file with coordinates for d6jlji_.
(The format of our PDB-style files is described here.)

Timeline for d6jlji_: