Lineage for d2efga3 (2efg A:476-599)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77712Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
  4. 77713Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families) (S)
  5. 77714Family d.14.1.1: Translational machinery components [54212] (3 proteins)
  6. 77715Protein Elongation factor G (EF-G), domain IV [54213] (1 species)
  7. 77716Species Thermus thermophilus [TaxId:274] [54214] (5 PDB entries)
  8. 77718Domain d2efga3: 2efg A:476-599 [37548]
    Other proteins in same PDB: d2efga1, d2efga2, d2efga4

Details for d2efga3

PDB Entry: 2efg (more details), 2.6 Å

PDB Description: translational elongation factor g complexed with gdp

SCOP Domain Sequences for d2efga3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2efga3 d.14.1.1 (A:476-599) Elongation factor G (EF-G), domain IV {Thermus thermophilus}
vgkpqvayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvip
keyipavqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavq
kgdp

SCOP Domain Coordinates for d2efga3:

Click to download the PDB-style file with coordinates for d2efga3.
(The format of our PDB-style files is described here.)

Timeline for d2efga3: