![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily) 6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops |
![]() | Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) ![]() automatically mapped to Pfam PF00421 |
![]() | Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins) Pfam PF00421 |
![]() | Protein automated matches [191285] (5 species) not a true protein |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [189912] (35 PDB entries) |
![]() | Domain d6jljb_: 6jlj B: [375472] Other proteins in same PDB: d6jlja_, d6jljd_, d6jlje_, d6jljf_, d6jljh_, d6jlji_, d6jljj_, d6jljk_, d6jljl_, d6jljm_, d6jljo_, d6jljt_, d6jlju_, d6jljv_, d6jljx_, d6jljz_ automated match to d4il6b_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 6jlj (more details), 2.15 Å
SCOPe Domain Sequences for d6jljb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jljb_ f.55.1.1 (B:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} glpwyrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgmf vlpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdle lfrdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqpv apewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlsss iaavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatleea wsaipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmpa ffesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksya rkaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfsg idpelspeqvewgfyqkvgdvttr
Timeline for d6jljb_: