Lineage for d1dar_3 (1dar 476-599)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 189110Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
  4. 189111Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families) (S)
  5. 189112Family d.14.1.1: Translational machinery components [54212] (3 proteins)
  6. 189113Protein Elongation factor G (EF-G), domain IV [54213] (1 species)
  7. 189114Species Thermus thermophilus [TaxId:274] [54214] (5 PDB entries)
  8. 189115Domain d1dar_3: 1dar 476-599 [37547]
    Other proteins in same PDB: d1dar_1, d1dar_2, d1dar_4

Details for d1dar_3

PDB Entry: 1dar (more details), 2.4 Å

PDB Description: elongation factor g in complex with gdp

SCOP Domain Sequences for d1dar_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dar_3 d.14.1.1 (476-599) Elongation factor G (EF-G), domain IV {Thermus thermophilus}
vgkpqvayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvip
keyipavqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavq
kgdp

SCOP Domain Coordinates for d1dar_3:

Click to download the PDB-style file with coordinates for d1dar_3.
(The format of our PDB-style files is described here.)

Timeline for d1dar_3: