Lineage for d6jljf_ (6jlj F:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026744Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 3026745Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 3026798Protein automated matches [191000] (6 species)
    not a true protein
  7. 3026823Species Thermosynechococcus vulcanus [TaxId:32053] [189914] (16 PDB entries)
  8. 3026831Domain d6jljf_: 6jlj F: [375463]
    Other proteins in same PDB: d6jlja_, d6jljb_, d6jljc_, d6jljd_, d6jljh_, d6jlji_, d6jljj_, d6jljk_, d6jljl_, d6jljm_, d6jljo_, d6jljt_, d6jlju_, d6jljv_, d6jljx_, d6jljz_
    automated match to d2axtf1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d6jljf_

PDB Entry: 6jlj (more details), 2.15 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (dark state, dataset1)
PDB Compounds: (F:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d6jljf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jljf_ f.23.38.1 (F:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
sypiftvrwvavhtlavptifflgaiaamqfiqr

SCOPe Domain Coordinates for d6jljf_:

Click to download the PDB-style file with coordinates for d6jljf_.
(The format of our PDB-style files is described here.)

Timeline for d6jljf_: