SCOP 1.59: Domain d1fnma3: 1fnm A:483-599

Lineage for d1fnma3 (1fnm A:483-599)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families)

5. Family d.14.1.1: Translational machinery components [54212] (3 proteins)

6. Protein Elongation factor G (EF-G), domain IV [54213] (1 species)

7. Species Thermus thermophilus [TaxId:274] [54214] (5 PDB entries)

8. Domain d1fnma3: 1fnm A:483-599 [37546]
   Other proteins in same PDB: d1fnma1, d1fnma2, d1fnma4, d1fnma5

Details for d1fnma3

PDB Entry: 1fnm, 2.8 Å

PDB Description: structure of thermus thermophilus ef-g h573a

SCOP Domain Sequences for d1fnma3:

Sequence; same for both SEQRES and ATOM records:

>d1fnma3 d.14.1.1 (A:483-599) Elongation factor G (EF-G), domain IV {Thermus thermophilus}
yretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipkeyipav
qkgieeamqsgpligfpvvdikvtlydgsyaevdssemafkiagsmaikeavqkgdp

Timeline for d1fnma3:

• d1fnma3 first appeared (with stable ids) in SCOP 1.55
  
• d1fnma3 appears in SCOP 1.57
  
• d1fnma3 appears in SCOP 1.61
  
• d1fnma3 appears in the current release, SCOPe 2.08