Lineage for d6jlpj_ (6jlp j:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631774Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families) (S)
    automatically mapped to Pfam PF01788
  5. 2631775Family f.23.32.1: PsbJ-like [161022] (2 proteins)
    Pfam PF01788
  6. 2631785Protein automated matches [191002] (3 species)
    not a true protein
  7. 2631793Species Thermosynechococcus vulcanus [TaxId:32053] [189916] (24 PDB entries)
  8. 2631817Domain d6jlpj_: 6jlp j: [375436]
    Other proteins in same PDB: d6jlpa_, d6jlpb_, d6jlpc_, d6jlpd_, d6jlpe_, d6jlpf_, d6jlph_, d6jlpi_, d6jlpk_, d6jlpl_, d6jlpm_, d6jlpo_, d6jlpt_, d6jlpu_, d6jlpv_, d6jlpx_, d6jlpz_
    automated match to d5ws5j_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d6jlpj_

PDB Entry: 6jlp (more details), 2.5 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (3f state, dataset2)
PDB Compounds: (j:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d6jlpj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jlpj_ f.23.32.1 (j:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
mseggriplwivatvagmgvivivglffygayaglgssl

SCOPe Domain Coordinates for d6jlpj_:

Click to download the PDB-style file with coordinates for d6jlpj_.
(The format of our PDB-style files is described here.)

Timeline for d6jlpj_: