SCOPe 2.07: Domain d6jlkt_: 6jlk T:

Lineage for d6jlkt_ (6jlk T:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family)
   automatically mapped to Pfam PF01405

5. Family f.23.34.1: PsbT-like [161030] (2 proteins)
   Pfam PF01405

6. Protein Photosystem II reaction center protein T, PsbT [161031] (3 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [224949] (23 PDB entries)

8. Domain d6jlkt_: 6jlk T: [375417]
   Other proteins in same PDB: d6jlka_, d6jlkb_, d6jlkc_, d6jlkd_, d6jlke_, d6jlkf_, d6jlkh_, d6jlki_, d6jlkj_, d6jlkk_, d6jlkl_, d6jlkm_, d6jlko_, d6jlku_, d6jlkv_, d6jlkx_, d6jlkz_
   automated match to d2axtt1
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d6jlkt_

PDB Entry: 6jlk, 2.15 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (1f state, dataset1)

PDB Compounds: (T:) Photosystem II reaction center protein T

SCOPe Domain Sequences for d6jlkt_:

Sequence; same for both SEQRES and ATOM records:

>d6jlkt_ f.23.34.1 (T:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus vulcanus [TaxId: 32053]}
metityvfifaciialfffaiffrepprit

Timeline for d6jlkt_:

• d6jlkt_ is new in SCOPe 2.07-stable
  
• d6jlkt_ appears in the current release, SCOPe 2.08