Lineage for d6jlkx_ (6jlk X:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2632179Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) (S)
    Pfam PF06596
  5. 2632180Family f.23.40.1: PsbX-like [267615] (2 proteins)
  6. 2632184Protein automated matches [267680] (2 species)
    not a true protein
  7. 2632198Species Thermosynechococcus vulcanus [TaxId:32053] [267915] (26 PDB entries)
  8. 2632212Domain d6jlkx_: 6jlk X: [375416]
    Other proteins in same PDB: d6jlka_, d6jlkb_, d6jlkc_, d6jlkd_, d6jlke_, d6jlkf_, d6jlkh_, d6jlki_, d6jlkj_, d6jlkk_, d6jlkl_, d6jlkm_, d6jlko_, d6jlkt_, d6jlku_, d6jlkv_, d6jlkz_
    automated match to d4il6x_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d6jlkx_

PDB Entry: 6jlk (more details), 2.15 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (1f state, dataset1)
PDB Compounds: (X:) Photosystem II reaction center protein X

SCOPe Domain Sequences for d6jlkx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jlkx_ f.23.40.1 (X:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
titpslkgffigllsgavvlgltfavliaisqidkvqrs

SCOPe Domain Coordinates for d6jlkx_:

Click to download the PDB-style file with coordinates for d6jlkx_.
(The format of our PDB-style files is described here.)

Timeline for d6jlkx_: