Lineage for d6jlpx_ (6jlp X:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2632179Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) (S)
    Pfam PF06596
  5. 2632180Family f.23.40.1: PsbX-like [267615] (2 proteins)
  6. 2632184Protein automated matches [267680] (2 species)
    not a true protein
  7. 2632198Species Thermosynechococcus vulcanus [TaxId:32053] [267915] (26 PDB entries)
  8. 2632222Domain d6jlpx_: 6jlp X: [375414]
    Other proteins in same PDB: d6jlpa_, d6jlpb_, d6jlpc_, d6jlpd_, d6jlpe_, d6jlpf_, d6jlph_, d6jlpi_, d6jlpj_, d6jlpk_, d6jlpl_, d6jlpm_, d6jlpo_, d6jlpt_, d6jlpu_, d6jlpv_, d6jlpz_
    automated match to d4il6x_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d6jlpx_

PDB Entry: 6jlp (more details), 2.5 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (3f state, dataset2)
PDB Compounds: (X:) Photosystem II reaction center protein X

SCOPe Domain Sequences for d6jlpx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jlpx_ f.23.40.1 (X:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
titpslkgffigllsgavvlgltfavliaisqidkvqrs

SCOPe Domain Coordinates for d6jlpx_:

Click to download the PDB-style file with coordinates for d6jlpx_.
(The format of our PDB-style files is described here.)

Timeline for d6jlpx_: