Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) |
Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins) Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284 |
Protein Cytochrome b559 subunit beta, PsbF [161049] (2 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [267725] (12 PDB entries) |
Domain d6jlpf_: 6jlp f: [375411] Other proteins in same PDB: d6jlpa_, d6jlpb_, d6jlpc_, d6jlpd_, d6jlpe_, d6jlph_, d6jlpi_, d6jlpj_, d6jlpk_, d6jlpl_, d6jlpm_, d6jlpo_, d6jlpt_, d6jlpu_, d6jlpv_, d6jlpx_, d6jlpz_ automated match to d3a0hf_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl |
PDB Entry: 6jlp (more details), 2.5 Å
SCOPe Domain Sequences for d6jlpf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jlpf_ f.23.38.1 (f:) Cytochrome b559 subunit beta, PsbF {Thermosynechococcus vulcanus [TaxId: 32053]} piftvrwvavhtlavptifflgaiaamqfiqr
Timeline for d6jlpf_: