Lineage for d6jlpf_ (6jlp f:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2632073Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 2632074Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 2632107Protein Cytochrome b559 subunit beta, PsbF [161049] (2 species)
  7. 2632114Species Thermosynechococcus vulcanus [TaxId:32053] [267725] (12 PDB entries)
  8. 2632125Domain d6jlpf_: 6jlp f: [375411]
    Other proteins in same PDB: d6jlpa_, d6jlpb_, d6jlpc_, d6jlpd_, d6jlpe_, d6jlph_, d6jlpi_, d6jlpj_, d6jlpk_, d6jlpl_, d6jlpm_, d6jlpo_, d6jlpt_, d6jlpu_, d6jlpv_, d6jlpx_, d6jlpz_
    automated match to d3a0hf_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d6jlpf_

PDB Entry: 6jlp (more details), 2.5 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (3f state, dataset2)
PDB Compounds: (f:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d6jlpf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jlpf_ f.23.38.1 (f:) Cytochrome b559 subunit beta, PsbF {Thermosynechococcus vulcanus [TaxId: 32053]}
piftvrwvavhtlavptifflgaiaamqfiqr

SCOPe Domain Coordinates for d6jlpf_:

Click to download the PDB-style file with coordinates for d6jlpf_.
(The format of our PDB-style files is described here.)

Timeline for d6jlpf_: