SCOPe 2.07: Domain d6jlph_: 6jlp H:

Lineage for d6jlph_ (6jlp H:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families)
   automatically mapped to Pfam PF00737

5. Family f.23.33.1: PsbH-like [161026] (2 proteins)
   Pfam PF00737

6. Protein Photosystem II reaction center protein H, PsbH [161027] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [267726] (20 PDB entries)

8. Domain d6jlph_: 6jlp H: [375407]
   Other proteins in same PDB: d6jlpa_, d6jlpb_, d6jlpc_, d6jlpd_, d6jlpe_, d6jlpf_, d6jlpi_, d6jlpj_, d6jlpk_, d6jlpl_, d6jlpm_, d6jlpo_, d6jlpt_, d6jlpu_, d6jlpv_, d6jlpx_, d6jlpz_
   automated match to d5v2ch_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d6jlph_

PDB Entry: 6jlp, 2.5 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (3f state, dataset2)

PDB Compounds: (H:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d6jlph_:

Sequence; same for both SEQRES and ATOM records:

>d6jlph_ f.23.33.1 (H:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus vulcanus [TaxId: 32053]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wkalg

Timeline for d6jlph_:

• d6jlph_ is new in SCOPe 2.07-stable
  
• d6jlph_ appears in the current release, SCOPe 2.08