Lineage for d6ihza2 (6ihz A:111-218)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2530460Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2530461Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2530930Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2530931Protein automated matches [190561] (4 species)
    not a true protein
  7. 2530932Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries)
  8. 3075320Domain d6ihza2: 6ihz A:111-218 [375382]
    Other proteins in same PDB: d6ihza3, d6ihzb3
    automated match to d3ps5a2
    mutant

Details for d6ihza2

PDB Entry: 6ihz (more details), 2.6 Å

PDB Description: the atomic structure of shp2 e76a mutant
PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d6ihza2:

Sequence, based on SEQRES records: (download)

>d6ihza2 d.93.1.0 (A:111-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthv
mircqelkydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnt

Sequence, based on observed residues (ATOM records): (download)

>d6ihza2 d.93.1.0 (A:111-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgddgkskvthvmircqe
lkydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnt

SCOPe Domain Coordinates for d6ihza2:

Click to download the PDB-style file with coordinates for d6ihza2.
(The format of our PDB-style files is described here.)

Timeline for d6ihza2:

  • d6ihza2 is new in SCOPe 2.07-stable