| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
| Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
| Protein Melibiase [75064] (4 species) |
| Species Human (Homo sapiens) [TaxId:9606] [102062] (21 PDB entries) alpha-galactosidase A |
| Domain d6ibka1: 6ibk A:32-323 [375366] Other proteins in same PDB: d6ibka2, d6ibkb2 automated match to d1r46a2 complexed with act, edo, nag, peg, so4, ytw missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 6ibk (more details), 1.99 Å
SCOPe Domain Sequences for d6ibka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ibka1 c.1.8.1 (A:32-323) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
ydidaqtfadwgvdllkfdgcycdslenladgykhmslalnrtgrsivyscewplymwpf
qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdp
Timeline for d6ibka1: